curl -H "Accept: text/plain" "https://rest.uniprot.org/uniprotkb/stream?format=fasta&query=%28%28go%3A0022414%29%29+AND+%28reviewed%3Atrue%29" -o ../data/SwissProt-GO:0022414.faUsing Swiss-Prot Repro subset..
Based on the following GO Term
https://www.ebi.ac.uk/QuickGO/term/GO:0022414
Make BlastDB
(Would only be needed once)
head ../data/SwissProt-GO:0022414.fa
echo "Number of Sequences"
grep -c ">" ../data/SwissProt-GO:0022414.fa >sp|A0A060A682|HAP2_TETTH Hapless 2 OS=Tetrahymena thermophila OX=5911 GN=HAP2 PE=1 SV=1
MKFLAFGLIYFHFCILNRCEYITSSTIQKCYNSSNEPNNCSQKAVIVLSLENGQIANTEQ
VVATLNQLSDSGVNKQLQNSFIFEVTKSPVTALFPLIYLQDFNSQPLEQVIATTLFSCKD
GFYDSSPTCKFQYDSKGQKILDSQGYCCYCSLSDILGMGNDLSRGKVCYALNLGAGSATA
HCLKFSPLWYSAFKIQQYQLYFEVNINIYTVDSQNQKNLKQTLKLSTSNPTMKSSDNSTI
SKIIGTFTPTQPPADLSSYYLVKPSFPATDPRVLQGISSWMFVDKTMFTLDGTQCNKIGV
SYSGFRQQSSSCSQPVGSCLQNQLENLYQSDLILLSQNKQPKYLLESQGNFNQVQFQGQT
ILQQGLSGSASTLITIEIDAAQIKFVTNLGIGCISQCSINNFESHSGNGKLVALVQNQGN
YSAEFVLGFNCSSNVQPIQGQKLFLTANQLYNFNCSVSVNSDISAINNNCTINLYDAIGN
QLDSKNILFNTTSTNHTSNQGNNTGQQQSSQEYKSSQSCSDKCSSFWSFWCYFSAGCIKE
Number of Sequences
12309/home/shared/ncbi-blast-2.11.0+/bin/makeblastdb \
-in ../data/SwissProt-GO:0022414.fa \
-dbtype prot \
-out ../blastdb/SwissProt-GO:0022414Set Query
set fasta as variable
fasta="../data/PO2457_Ostrea_lurida.protein.fasta"
head $fasta
echo "Number of Sequences"
grep ">" -c $fasta>ANN15860-RA
MTDFGIYEVPVQTGVNHTTSSCALQCEIRTTCTLFRINKLTSECDFYNGGRYKTAIPVQGNQFYQKVPDSANCISGRDEWFPEYQKCIWIHMEALNHQEAKDRCESGGKIMMGAKDTTQIKSLMNLLDFKWIHVYALRVGQKSYEWFDGSSVSSTNWWCSDQPYEDSACLGVDLSMIHWCLAGGIDDIPCTDDRTFFCV
>ANN15859-RA
MYLCKDFYAIMESSKGDDCENDEDACLQNPCPMDRNCTDLSPDEETAFGRGYNCTPCPSGYQDIDNKCEDLDECNNNSTNICDSFTQDCENTEGGYDCTCKTGYRKVGQTCHDIDECSESTSDCQQICTNSPGSFSCSCVVGHSLNSDNKNCTAQVTDICYDAGLSCEYTCDNSTGTFVCVCPSGYELESNGQNCTVVRGIRVRIGLQHPLACRKRRLNGAVIRMRLEKPRSRVTADIDECTRSVCSQACNNTIGSYSCFCFPGYSLNSDKTTCLACEAPYYGDNCGQVCRCGAGLESCDQVHGCLCLSGWTGTSCNLDIDECTANPAICGSDKICKNLQGSYTCNCREGFEKNGTECVDIDECTNADNNNCNEWTSMCQNTYGGYTCKCLTGYKKKISYYGEILDAFVCHDIDECALDTHDCAQTCTNADGGYHCGCQFGFVLADDRRSCERVSDIASLFPSLNCSYAYKENPSNTSAAYCFCENGYYLHPKDQQSCIDVNECQFYSDTYVVLNKCSNYYHRFTNCVNVPGSYQCTCPPVGFVLENDERTCAVCDGFHYGEDCKTPCNCGPGALTCDNLRGCQCKMGWAGSRCEADIDECSTGTLCTGTNQVCQNTPGSYQCICDTGYKAIRWGICIDIDECNTGTNPCSQVCTNTPGSYYCSCNTGFRLVGTSQCDDYDECSAPVSACDQVCVNTVGSYKCSCNPGFLLNSTTRTTCYSKTVCTNTTLNCSQQCGVNSGGSEYCFCNIGYTLNADGFSCDDRDECSPNPCSENCSQNAPGAGYTCSCSVGKKLDVDQRTCIDCDTGTYGLNCATNCSCNDQNTKSCDKVTGSCICKTGWEGTNCSSDINECLNKTICPSISNCFNNVGTYSCICPSGYSLIGGQCIECSSSTYGLNCGSSCSCKFIFTQSCNKQNGGCSCMFGRDAPNCRYDIGECFNPNTCNLNNSFCSEEPFPYMCICLKGYEYEKHSNGTCIDINECARGTSNCDKNAVCINTEGSFNCSCKSGFTGNGLTCTAALTTTQRVTPGDVTTQRVTPSDVTTQRVTPSGVTTQRVTPGDVTTQRVTPGDVTTPRVTPGDVTTPRVTPGYVTTQRVTPGDVTTTQVIPVDVTTPRVTPGDITTPRVTPGDITTLRVTPGDVTTPRVTPGDVTTLRVTPGDVTTPRVTPGDVTIPHFTPGVVTTQRVTPGDVTTPRVTPGDVITPRITSGDVTSSESVTTDTSTTPVTSQSTEVPTTYTPATGEALFSVSFTFSIDGKQDEKEAIQSEMLTALTALYTGRIKGFIKVILIDSRLGGLIGDHSVVTSSNTPVETRSDFTRTLNNLAKGALKITYNGTQYPVWAIAVADSTGNLQNVSVLVSSTVCQVFDTLNTCPRGQQCDDLDGIVQCRVIEINSKQDSLKVIVGLGVGIPLSFIVVLVLAIIWICYCRQKHKERYFSSKDDLDKTMHTDGFLISGIPTRIFSLGWRVPHALRNWGDDSSTSDVNERRGRRGRGFGNTYRGGRQLYSELIFNYRMMGNF
>ANN15862-RA
MSVTYLKGLSTRYRNLTEKEIKRGDELVSVDISEENPTVLLRNVETSSRRIKEFSGKLEETMEKWSMAIEDKETQQGEHDKFSEISEVVFNLLAEANESSDQLVILEKTLQEHLATLKKPAEMTDPRLEQMIHLQSKMQEQILHFQELSLQQHRPGQVAVKLPKLELPTYNGDKIKFKEFWDAFDATVHKNPKLSNIEKFNYLRSKLIGPAHVAISGLSLSNENYDVAITILRDRFGDTQSVINKHYVELINTQCATNDTLSLRKLYDDLERHLRSLEALHQDVNQDVFISMITSKLPKETLLQLEIQKGPKGKWTVQKLRELLKGYITVKESSELQAASVAVHEDKHMTAEALVISTKESTIKHDRQTRRSEKSPMCTYCDGSHWTDECRRYRTIEDRKQRLKGKCFICLKSGHRSKECRVVKACYHCKQTGDHHRSLCPKKFTLRHRESTNTHLTEEVCRTSETPKRSTMSENSLLSSGDIVLMQTARTEVSNQCRENSEPARLLMDSGSQRTYITEKLADKLKLKTRITEKISLITFGAEKPKIVKTPKVSLTIKLKDGQYLSIEANVVPQITGTVQRKPIPKDVQERCQNIWKNLQLADTLPENFEDSTIDILVGSDYYLDLILPERIEIQRGFYLLASRLGWILTGRTQETFGREEQVMMITNGTLSLTEYCLHSAVDECIFTNSLDDFWNLEAIGIQDSPYTSDDERALENFNKTLKIEDNRYQVTWPWKEEFPELPENRELAFGRLKSLVHKLQRNPDLLHKYDDIIQDQCTRGIIEKIPSNHRETGVKHYIPHHAVVDLTKPTTKVRIVYDASAKTEHSHSSLNECLHRGPVMLHDLCGLLMRFRLKKIGIIADIEKAFLQIGLQEKDRNATRFFWLKDATNPTVEDNVQVYRFCRVPFGVISSPFLLAATVDHHLSSYNSETAENIRNNIYVDNVITGVDTIQEAEILYKEAKQIFGDISMNLRDWSSNAEEFHRFIPTEDQSARENLKILGLTWDLKEDVLTVPYQKSKTAPVTKREVLQRVASIFDPLGFFTPVTLKAKLFLQTLWQKNLEWDAPLTKEDIQEWKVIAADLVDIQYCQIPRYLGLSGEVSYRLLCFCDASAKAFATVVYLQLIDASSNICRLVFSKTRLAPTKQITMPRLELLAVLIGVRSMCFVENQLKLKISEKILWTDPQCVLHWIKTKKPLTVFVENRVKEIREKVDLELQYVTSADNPADIASRGIMAETLKDSMQWWNGPSWLTEKKSQWPVWNPSSNDIHSDAIESEYKKPRVMYEAKLLAGEGPPGYKDTCAEQKNPFDIDAERFSSFMKLIRVLAWIQRFIKKLKREKSACGPLTVEEMEEAKILLIKSIQNQNYTDVKSALIEKKRHNLVNQLGLTLDEDGIIRCIGRLGAAQLTEGARAPILLPKKNHVTDLLIDSYHRKSLHAGVSQTLSIVRQTYWIPQGRAEVRRVLRKCTVCKRHEGGPYRMPLMPPLPRKRVNESSPFTYTGVDYFGPIYVKANSGTKKVWVCLFTCLVVRSVHLELMQDMSTEEFLLGLRRFIARWGKPRQLISDNASQFKLASGVIEKAWSSTVSDVDVQSYVANEDMKWQFIVELAPWMGGFYERLIGVVKRCLRKTIGKLCLAFEQLRTLLAEAEAAVNSRPLVYVGDDINSNITLTPAHFLSLNPKIGISGCGEEENTEDPEYLPNISNAEVLLQTWKKGQKHLDAFWKAWRDDYLLSLRERTAYKLKEGRIQHCKEPQIDDVVLIKDDLPRGSWKIGRVCELRASQDGQIRSGKVLLPNKKTLNRPLNLLYPIECSKETENSDSEATKENQSTESDHGTVSGIESVTKPKSQPVLRETPDARPKRRSARRAEEKIKDWLNP
>ANN15865-RA
MMALLDQEENNFIRAIFTIHAIAPKAVKRLFKNRHPDNGILTQELSAIKSDLMRTKGFPKHMAFLIFPSQGKHVNPDEFDLSVLIFLLQNFSNLPAPIKGWNTKPPITDSSEAADLTRIRLIRNDLAHNNDGKLKQSEFEVLWKELERVSIFRYLNFIIYLCAHGGCDRSAEDAYSSMAPDPAFASSKALGRLGEGVYDDELKNCKIATRENIDDMKRQVQELSDEIKFFEIATRENIDDMNTQVQGLREELQSPVPFNIRRDMLEEVEEWRKENEDFYETNFARNLHQAAAKEDFIMIIGEPGSGKTTTMHHIALKLNVEGGYDILPIQKPSEIKQYYSNNKRQVFVIDDAVGVHSLNDAMMREWEDLKPSLKRWKLLMINDFVKQSTKLTDPRNHVREMQEKHQCKILVSCRSFLTKTDAFPAFLREIEIVDAQNSRNRIGYLERQNIFATIFRTTRESIPLSKEIVMQYDSFPLLCRMCCSQGTIKPEVFFKRPFKHYFEEIDRMFHENKLSYFVLIFCLVFRCSFPDKPNSDTMEGFHSILDKCHLNQGTSYEEIRATILAMKDTYLRKVGEDEYDFYHIIIRDIIAYHFHSKSGLPILTKYGSDSFIRDRIRPKGPLPEDNPDDGYLIELKKDELSNFIERVCKNLMVKDWLVTFNSNFLPDAELEMHICKYLDRTNQFHSLLKRTNKHQSPNDLTKIQSYNRLLAALVDFPYKKTYQDIYHLRKEVLRPLTFIFWLIGFGWFEMFKAAFAISDTNITREIENSRHATLVLSALGGDEKMIRFINKSIVKSNSRCFICKTSAFLETFFVHCCNCPINHLSGFTIACIMGNGKVANYLKGILSYSADTEFDVSVLENFCTPKVGYLRHYRVSVMEIACNLGHMDMVCHFFKEKKLRIGTVKKSLLMACQNGQKDVFEFLLTEIPKDRFKDIDIRSLLKRSLYIASYFGHEMLVALLLERNVPVDTCDTSKRTPLLAASGRGHINVAKVLFSSGANVNSSDVFGWTPLKVACAKGYTEIVRLLLTNDDIILDDPNSDKCTSENRELPIRVTDEVSDTLLRRVFVSRTYNAILAVFPGYDLFPLFLASCNGHHEIVELLLSKGVSVDRTIEVGGIESSLTVASSNGYPKVVSLLLAHGASLYVEGSGRTALMSVCSSEGNSFNIIPNSVYRETDKYFLGDANHLEAVKEILSKDNSQQFLDTKDEEGMSALHFASLNCHSDIIDLLLVQNIEINTRNSSGITPLWLASKYDYPEIVSILVSHDADVNICSKDKHSPLWIACAERTEGYGLFDTVWTHGKVISMLLTKADIDSIGIENLTALNIACMKDDDELVSYLLSKGASIGNNLLLAFLQTHFKIAGLLILEKIRRL
>ANN15866-RA
MLTPTRHLIPPLGTTNVRILYLNGEFLLDSLERIRERVPKFSSAVALVDFYARLTHTGKDYNCKWTEDLSIALQKPKPHRVVNLRHLCRLSINRSVPNTVTRTEMLGYLDKLPVSRHLKTYLKEYPYIH
Number of Sequences
33939Blast
fasta="../data/PO2457_Ostrea_lurida.protein.fasta"
/home/shared/ncbi-blast-2.15.0+/bin/blastp \
-query $fasta \
-db ../blastdb/SwissProt-GO:0022414 \
-out ../output/04-repro-annot/blastout.tab \
-evalue 1E-20 \
-num_threads 48 \
-max_target_seqs 1 \
-max_hsps 1 \
-outfmt 6head ../output/04-repro-annot/blastout.tabANN15859-RA sp|P07207|NOTCH_DROME 27.146 1072 523 60 96 1012 162 1130 5.83e-40 162
ANN15865-RA sp|Q9VCA8|ANKHM_DROME 27.049 366 193 9 907 1269 2316 2610 1.97e-24 110
ANN15898-RA sp|Q9Z0E8|S22A5_MOUSE 27.604 576 327 13 236 784 12 524 4.19e-57 204
ANN15903-RA sp|Q9Z0E8|S22A5_MOUSE 29.242 554 337 11 16 545 2 524 1.16e-63 217
ANN15914-RA sp|P49891|ST1E1_MOUSE 31.250 256 153 8 28 269 49 295 2.65e-26 103
ANN04321-RA sp|O15455|TLR3_HUMAN 22.802 671 421 18 29 655 238 855 1.93e-26 114
ANN04322-RA sp|P15620|ZN271_MOUSE 24.554 505 321 18 1022 1523 80 527 2.78e-26 114
ANN04330-RA sp|O88572|LRP6_MOUSE 27.494 902 546 38 66 930 65 895 9.40e-60 226
ANN04334-RA sp|P20241|NRG_DROME 25.049 507 314 23 299 765 26 506 2.24e-24 109
ANN04339-RA sp|Q969R2|OSBP2_HUMAN 50.591 761 322 13 11 757 184 904 0.0 749wc -l ../output/04-repro-annot/blastout.tab4641 ../output/04-repro-annot/blastout.tabtr '|' '\t' < ../output/04-repro-annot/blastout.tab \
> ../output/04-repro-annot/blastout_sep.tab
head -1 ../output/04-repro-annot/blastout_sep.tabANN15859-RA sp P07207 NOTCH_DROME 27.146 1072 523 60 96 1012 162 1130 5.83e-40 162Download Swiss-Prot Information
curl -H "Accept: text/plain; format=tsv" "https://rest.uniprot.org/uniprotkb/stream?fields=accession%2Creviewed%2Cid%2Cprotein_name%2Cgene_names%2Corganism_name%2Clength%2Cgo_p%2Cgo_c%2Cgo%2Cgo_f%2Cgo_id&format=tsv&query=%28%28go%3A0022414%29%29+AND+%28reviewed%3Atrue%29" -o ../data/SwissProt-GO:0022414.tsvJoin blast with GO info
bltabl <- read.csv("../output/04-repro-annot/blastout_sep.tab", sep = '\t', header = FALSE)
spgo <- read.csv("../data/SwissProt-GO:0022414.tsv", sep = '\t', header = TRUE)annot_tab <-
left_join(bltabl, spgo, by = c("V3" = "Entry")) %>%
select(V1, V3, V13, Protein.names, Organism, Gene.Ontology..biological.process., Gene.Ontology.IDs)head(annot_tab) V1 V3 V13
1 ANN15859-RA P07207 5.83e-40
2 ANN15865-RA Q9VCA8 1.97e-24
3 ANN15898-RA Q9Z0E8 4.19e-57
4 ANN15903-RA Q9Z0E8 1.16e-63
5 ANN15914-RA P49891 2.65e-26
6 ANN04321-RA O15455 1.93e-26
Protein.names
1 Neurogenic locus Notch protein [Cleaved into: Processed neurogenic locus Notch protein]
2 Ankyrin repeat and KH domain-containing protein mask (Multiple ankyrin repeat single KH domain-containing protein)
3 Organic cation/carnitine transporter 2 (High-affinity sodium-dependent carnitine cotransporter) (Solute carrier family 22 member 5)
4 Organic cation/carnitine transporter 2 (High-affinity sodium-dependent carnitine cotransporter) (Solute carrier family 22 member 5)
5 Sulfotransferase 1E1 (ST1E1) (EC 2.8.2.4) (Estrogen sulfotransferase, testis isoform) (Sulfotransferase, estrogen-preferring)
6 Toll-like receptor 3 (CD antigen CD283)
Organism
1 Drosophila melanogaster (Fruit fly)
2 Drosophila melanogaster (Fruit fly)
3 Mus musculus (Mouse)
4 Mus musculus (Mouse)
5 Mus musculus (Mouse)
6 Homo sapiens (Human)
Gene.Ontology..biological.process.
1 actin filament organization [GO:0007015]; asymmetric cell division [GO:0008356]; axon guidance [GO:0007411]; border follicle cell migration [GO:0007298]; cell dedifferentiation [GO:0043697]; cell differentiation [GO:0030154]; cell fate commitment [GO:0045165]; chaeta development [GO:0022416]; chaeta morphogenesis [GO:0008407]; compartment boundary maintenance [GO:0060289]; compound eye development [GO:0048749]; compound eye morphogenesis [GO:0001745]; compound eye retinal cell programmed cell death [GO:0046667]; crystal cell differentiation [GO:0042688]; defense response to insect [GO:0002213]; determination of adult lifespan [GO:0008340]; dorsal appendage formation [GO:0046843]; dorsal closure [GO:0007391]; dorsal/ventral axis specification [GO:0009950]; embryonic hemopoiesis [GO:0035162]; epithelial cell proliferation involved in Malpighian tubule morphogenesis [GO:0061331]; epithelial cell type specification, open tracheal system [GO:0035153]; eye-antennal disc development [GO:0035214]; eye-antennal disc morphogenesis [GO:0007455]; female germ-line stem cell population maintenance [GO:0036099]; follicle cell of egg chamber development [GO:0030707]; follicle cell of egg chamber migration [GO:0007297]; follicle cell of egg chamber stalk formation [GO:0030713]; foregut morphogenesis [GO:0007440]; formation of a compartment boundary [GO:0060288]; germ-line stem cell population maintenance [GO:0030718]; germ-line stem-cell niche homeostasis [GO:0060250]; germarium-derived egg chamber formation [GO:0007293]; glial cell differentiation [GO:0010001]; glial cell fate determination [GO:0007403]; glial cell migration [GO:0008347]; hemocyte proliferation [GO:0035172]; imaginal disc-derived leg joint morphogenesis [GO:0016348]; imaginal disc-derived leg morphogenesis [GO:0007480]; imaginal disc-derived leg segmentation [GO:0036011]; imaginal disc-derived male genitalia morphogenesis [GO:0048803]; imaginal disc-derived wing margin morphogenesis [GO:0008587]; imaginal disc-derived wing morphogenesis [GO:0007476]; imaginal disc-derived wing vein specification [GO:0007474]; intestinal stem cell homeostasis [GO:0036335]; lamellocyte differentiation [GO:0035171]; larval lymph gland hemopoiesis [GO:0035167]; lateral inhibition [GO:0046331]; leg disc morphogenesis [GO:0007478]; long-term memory [GO:0007616]; lymph gland development [GO:0048542]; Malpighian tubule tip cell differentiation [GO:0061382]; mesoderm development [GO:0007498]; morphogenesis of an epithelial fold [GO:0060571]; motor neuron axon guidance [GO:0008045]; muscle cell cellular homeostasis [GO:0046716]; muscle cell fate determination [GO:0007521]; myoblast development [GO:0048627]; negative regulation of cell-cell adhesion mediated by cadherin [GO:2000048]; negative regulation of compound eye photoreceptor development [GO:0045316]; negative regulation of gene expression [GO:0010629]; negative regulation of lamellocyte differentiation [GO:0035204]; negative regulation of neurogenesis [GO:0050768]; negative regulation of Notch signaling pathway [GO:0045746]; nervous system process [GO:0050877]; neuroblast development [GO:0014019]; neuroblast fate determination [GO:0007400]; neuroblast fate specification [GO:0014018]; neuroblast proliferation [GO:0007405]; neuron fate determination [GO:0048664]; neuron fate specification [GO:0048665]; neuronal stem cell population maintenance [GO:0097150]; Notch signaling pathway [GO:0007219]; ommatidial rotation [GO:0016318]; oocyte localization involved in germarium-derived egg chamber formation [GO:0030720]; oogenesis [GO:0048477]; peripheral nervous system development [GO:0007422]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of crystal cell differentiation [GO:0042691]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of gene expression [GO:0010628]; positive regulation of neuroblast proliferation [GO:0002052]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of transcription by RNA polymerase II [GO:0045944]; R1/R6 cell differentiation [GO:0048052]; R3/R4 cell differentiation [GO:0048056]; R7 cell differentiation [GO:0045466]; regulation of cardioblast cell fate specification [GO:0042686]; regulation of cell differentiation [GO:0045595]; regulation of filopodium assembly [GO:0051489]; regulation of glycolytic process [GO:0006110]; regulation of growth [GO:0040008]; regulation of mitotic cell cycle [GO:0007346]; regulation of neuroblast proliferation [GO:1902692]; regulation of neurogenesis [GO:0050767]; regulation of stem cell division [GO:2000035]; response to symbiont [GO:0009608]; retinal cell programmed cell death [GO:0046666]; second mitotic wave involved in compound eye morphogenesis [GO:0016330]; sensory organ development [GO:0007423]; sensory organ precursor cell fate determination [GO:0016360]; stem cell differentiation [GO:0048863]; wing disc dorsal/ventral pattern formation [GO:0048190]; wing disc pattern formation [GO:0035222]
2 compound eye photoreceptor cell differentiation [GO:0001751]; dorsal appendage formation [GO:0046843]; flight [GO:0060361]; innate immune response [GO:0045087]; mitochondrion organization [GO:0007005]; negative regulation of autophagy of mitochondrion [GO:1903147]; negative regulation of establishment of blood-brain barrier [GO:0090212]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of sevenless signaling pathway [GO:0045874]; positive regulation of transcription by RNA polymerase II [GO:0045944]; sarcomere organization [GO:0045214]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]; wound healing, spreading of cells [GO:0044319]; wound healing, spreading of epidermal cells [GO:0035313]
3 (R)-carnitine transmembrane transport [GO:1902270]; (R)-carnitine transport [GO:1900749]; adult heart development [GO:0007512]; carnitine metabolic process [GO:0009437]; carnitine transport [GO:0015879]; establishment of localization in cell [GO:0051649]; locomotory behavior [GO:0007626]; mitochondrion organization [GO:0007005]; quaternary ammonium group transport [GO:0015697]; reproductive structure development [GO:0048608]; response to tumor necrosis factor [GO:0034612]; response to type II interferon [GO:0034341]; sodium ion transport [GO:0006814]; transport across blood-brain barrier [GO:0150104]
4 (R)-carnitine transmembrane transport [GO:1902270]; (R)-carnitine transport [GO:1900749]; adult heart development [GO:0007512]; carnitine metabolic process [GO:0009437]; carnitine transport [GO:0015879]; establishment of localization in cell [GO:0051649]; locomotory behavior [GO:0007626]; mitochondrion organization [GO:0007005]; quaternary ammonium group transport [GO:0015697]; reproductive structure development [GO:0048608]; response to tumor necrosis factor [GO:0034612]; response to type II interferon [GO:0034341]; sodium ion transport [GO:0006814]; transport across blood-brain barrier [GO:0150104]
5 estrogen metabolic process [GO:0008210]; female pregnancy [GO:0007565]; sulfation [GO:0051923]
6 activation of NF-kappaB-inducing kinase activity [GO:0007250]; cellular response to exogenous dsRNA [GO:0071360]; cellular response to interferon-beta [GO:0035458]; cellular response to mechanical stimulus [GO:0071260]; cellular response to type II interferon [GO:0071346]; cellular response to virus [GO:0098586]; cellular response to xenobiotic stimulus [GO:0071466]; defense response to bacterium [GO:0042742]; defense response to virus [GO:0051607]; detection of virus [GO:0009597]; extrinsic apoptotic signaling pathway [GO:0097191]; hyperosmotic response [GO:0006972]; I-kappaB phosphorylation [GO:0007252]; inflammatory response to wounding [GO:0090594]; innate immune response [GO:0045087]; JNK cascade [GO:0007254]; male gonad development [GO:0008584]; microglial cell activation [GO:0001774]; necroptotic signaling pathway [GO:0097527]; negative regulation of osteoclast differentiation [GO:0045671]; positive regulation of angiogenesis [GO:0045766]; positive regulation of apoptotic process [GO:0043065]; positive regulation of canonical NF-kappaB signal transduction [GO:0043123]; positive regulation of chemokine production [GO:0032722]; positive regulation of cytokine production involved in inflammatory response [GO:1900017]; positive regulation of gene expression [GO:0010628]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interferon-alpha production [GO:0032727]; positive regulation of interferon-beta production [GO:0032728]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of JNK cascade [GO:0046330]; positive regulation of macrophage cytokine production [GO:0060907]; positive regulation of non-canonical NF-kappaB signal transduction [GO:1901224]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of type II interferon production [GO:0032729]; positive regulation of type III interferon production [GO:0034346]; regulation of dendritic cell cytokine production [GO:0002730]; response to dsRNA [GO:0043331]; response to exogenous dsRNA [GO:0043330]; signal transduction [GO:0007165]; toll-like receptor 3 signaling pathway [GO:0034138]; toll-like receptor signaling pathway [GO:0002224]; type III interferon production [GO:0034343]
Gene.Ontology.IDs
1 GO:0001745; GO:0002052; GO:0002213; GO:0003682; GO:0003713; GO:0004888; GO:0005112; GO:0005509; GO:0005634; GO:0005654; GO:0005737; GO:0005768; GO:0005769; GO:0005770; GO:0005771; GO:0005783; GO:0005788; GO:0005796; GO:0005829; GO:0005886; GO:0005912; GO:0006110; GO:0007015; GO:0007219; GO:0007293; GO:0007297; GO:0007298; GO:0007346; GO:0007391; GO:0007400; GO:0007403; GO:0007405; GO:0007411; GO:0007422; GO:0007423; GO:0007440; GO:0007455; GO:0007474; GO:0007476; GO:0007478; GO:0007480; GO:0007498; GO:0007521; GO:0007616; GO:0008045; GO:0008284; GO:0008340; GO:0008347; GO:0008356; GO:0008407; GO:0008587; GO:0009608; GO:0009950; GO:0009986; GO:0010001; GO:0010628; GO:0010629; GO:0014018; GO:0014019; GO:0016020; GO:0016318; GO:0016324; GO:0016330; GO:0016348; GO:0016360; GO:0022416; GO:0030139; GO:0030154; GO:0030707; GO:0030713; GO:0030718; GO:0030720; GO:0032991; GO:0035035; GO:0035153; GO:0035162; GO:0035167; GO:0035171; GO:0035172; GO:0035204; GO:0035214; GO:0035222; GO:0036011; GO:0036099; GO:0036335; GO:0040008; GO:0042686; GO:0042688; GO:0042691; GO:0043525; GO:0043697; GO:0045165; GO:0045316; GO:0045466; GO:0045595; GO:0045746; GO:0045893; GO:0045944; GO:0046331; GO:0046666; GO:0046667; GO:0046716; GO:0046843; GO:0048052; GO:0048056; GO:0048190; GO:0048477; GO:0048542; GO:0048627; GO:0048664; GO:0048665; GO:0048749; GO:0048803; GO:0048863; GO:0050699; GO:0050767; GO:0050768; GO:0050877; GO:0051489; GO:0060250; GO:0060288; GO:0060289; GO:0060571; GO:0061331; GO:0061382; GO:0097150; GO:1900087; GO:1902692; GO:1990433; GO:2000035; GO:2000048
2 GO:0001751; GO:0003723; GO:0005634; GO:0005737; GO:0005829; GO:0007005; GO:0019901; GO:0030018; GO:0031430; GO:0035313; GO:0044319; GO:0045087; GO:0045214; GO:0045874; GO:0045944; GO:0046427; GO:0046843; GO:0048010; GO:0060361; GO:0090212; GO:0090575; GO:1903147
3 GO:0005524; GO:0005737; GO:0005829; GO:0005886; GO:0006814; GO:0007005; GO:0007512; GO:0007626; GO:0009437; GO:0009925; GO:0015199; GO:0015226; GO:0015293; GO:0015651; GO:0015697; GO:0015879; GO:0016020; GO:0016323; GO:0016324; GO:0031526; GO:0034341; GO:0034612; GO:0048608; GO:0051649; GO:0150104; GO:1900749; GO:1901235; GO:1902270
4 GO:0005524; GO:0005737; GO:0005829; GO:0005886; GO:0006814; GO:0007005; GO:0007512; GO:0007626; GO:0009437; GO:0009925; GO:0015199; GO:0015226; GO:0015293; GO:0015651; GO:0015697; GO:0015879; GO:0016020; GO:0016323; GO:0016324; GO:0031526; GO:0034341; GO:0034612; GO:0048608; GO:0051649; GO:0150104; GO:1900749; GO:1901235; GO:1902270
5 GO:0004062; GO:0004304; GO:0005496; GO:0005737; GO:0005829; GO:0007565; GO:0008146; GO:0008210; GO:0050294; GO:0051923
6 GO:0000139; GO:0001774; GO:0002224; GO:0002730; GO:0003725; GO:0004888; GO:0005615; GO:0005737; GO:0005765; GO:0005769; GO:0005789; GO:0005886; GO:0006972; GO:0007165; GO:0007250; GO:0007252; GO:0007254; GO:0008584; GO:0009597; GO:0010008; GO:0010628; GO:0016020; GO:0031012; GO:0032722; GO:0032727; GO:0032728; GO:0032729; GO:0032735; GO:0032755; GO:0032757; GO:0032760; GO:0034138; GO:0034343; GO:0034346; GO:0035458; GO:0036020; GO:0038023; GO:0038187; GO:0042742; GO:0042802; GO:0043065; GO:0043123; GO:0043330; GO:0043331; GO:0045087; GO:0045671; GO:0045766; GO:0045944; GO:0046330; GO:0050729; GO:0051607; GO:0060907; GO:0071260; GO:0071346; GO:0071360; GO:0071466; GO:0090594; GO:0097191; GO:0097527; GO:0098586; GO:1900017; GO:1901224